PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00219g06001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family BES1
Protein Properties Length: 330aa    MW: 35269.4 Da    PI: 8.2695
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00219g06001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8222106.1e-65371663133
                    DUF822   3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssas 87 
                               ++rkp+w+ErEnn+rRERrRRa+aakiy+GLRaqGny+lpk +DnneVlkALc+eAGw+ve+DGtty+kg+kp+ ++e++g+sa+
  Niben101Scf00219g06001.1  37 GRRKPSWRERENNRRRERRRRAMAAKIYTGLRAQGNYNLPKNCDNNEVLKALCAEAGWIVEPDGTTYPKGCKPT-SMEIGGTSAN 120
                               79************************************************************************.********** PP

                    DUF822  88 aspesslqsslkssalaspvesysaspksssfpspssldsislasa 133
                               + p+ss + s+ ss++asp++sy++sp+sssfpspss+d ++++ +
  Niben101Scf00219g06001.1 121 IMPSSSWNPSPPSSYFASPIPSYQPSPTSSSFPSPSSADANMSSYP 166
                               ***************************************9987643 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056878.2E-6037162IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MMWEAGGGLT ASSSAAGSGG GSGGAGGCLP GSGSNCGRRK PSWRERENNR RRERRRRAMA  60
AKIYTGLRAQ GNYNLPKNCD NNEVLKALCA EAGWIVEPDG TTYPKGCKPT SMEIGGTSAN  120
IMPSSSWNPS PPSSYFASPI PSYQPSPTSS SFPSPSSADA NMSSYPFAFL HNVIPSSLPP  180
LRISNSAPVT PPLSSPTRHP KQTFNLETLG KESMSALNIP FFAASAPASP TRGRRFTPPT  240
IPECDESDTS TIDSGQWINF QKYATNVPAS PSFNLVKPVA QPLCSNDIIT EKGKSIEFDF  300
ENVSVKAWEG ERIHDVGFDD LELTLGSARI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13756RRKPSWRERENNRRRERRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-109BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLM1B8X31e-164M1B8X3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000398791e-164(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.23e-90BES1 family protein